Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr113 siRNA (m)
sc-150302 10 µM

Olfr113 siRNA (m)

Sign In for Pricing
View Details
POC5 antibody - C-terminal region
MBS3209307-01 0.1 mL

POC5 antibody - C-terminal region

Sign In for Pricing
View Details
POC5 antibody - C-terminal region
MBS3209307-02 5x 0.1 mL

POC5 antibody - C-terminal region

Sign In for Pricing
View Details
SCRAPPER Antibody : Biotin (OAPB00621-Biotin)
OAPB00621-100UG-Biotin 0.1 mg

SCRAPPER Antibody : Biotin (OAPB00621-Biotin)

Sign In for Pricing
View Details
CAPN1 (aa468-481) Antibody
orb99061 100 µg

CAPN1 (aa468-481) Antibody

Sign In for Pricing
View Details
CAPZB Antibody
45-359 0.1 mg

CAPZB Antibody

Sign In for Pricing
View Details