Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 2-18 (LV218)

This Recombinant Human Immunoglobulin lambda variable 2-18 (LV218) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 2-18 IGLV2-18

UniProt

A0A075B6J9

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human H1-8 qPCR Primer Pair
QH62613S 200 Tests

Human H1-8 qPCR Primer Pair

Sign In for Pricing
View Details
QualiStem® iPSC Protein Reprogrammin Kit II (OSNL)
CSK-IP008 One Kit

QualiStem® iPSC Protein Reprogrammin Kit II (OSNL)

Sign In for Pricing
View Details
PPH3 Antibody
orb848680 2 mg

PPH3 Antibody

Sign In for Pricing
View Details
Collagen VI (COL6A1) (NM_001848) Human Tagged Lenti ORF Clone
RC208562L3 10 µg

Collagen VI (COL6A1) (NM_001848) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfr1349-set siRNA/shRNA/RNAi Lentivector (Mouse)
32799094 4x 500 ng

Olfr1349-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
CEP72, ID (CEP72, KIAA1519, Centrosomal protein of 72kD) (Azide free) (HRP) discontinued
033784-HRP 200 µL

CEP72, ID (CEP72, KIAA1519, Centrosomal protein of 72kD) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details