Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 2-18 (LV218)

This Recombinant Human Immunoglobulin lambda variable 2-18 (LV218) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 2-18 IGLV2-18

UniProt

A0A075B6J9

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNH Antibody, Biotin conjugated
CSB-PA004822LD01HU-01 50 µg

CCNH Antibody, Biotin conjugated

Sign In for Pricing
View Details
CCNH Antibody, Biotin conjugated
CSB-PA004822LD01HU-02 100 µg

CCNH Antibody, Biotin conjugated

Sign In for Pricing
View Details
SPATA18 Rabbit Polyclonal Antibody (Carrier-free)
orb3096884 100 µg

SPATA18 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
RPL36AP23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1980807 1.0 µg DNA

RPL36AP23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ZNF517 Double Nickase Plasmid (h)
sc-415539-NIC 20 µg

ZNF517 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Goat anti-Human IgM-Fc Fragment Antibody FITC Conjugated
A80-100F 1 mg

Goat anti-Human IgM-Fc Fragment Antibody FITC Conjugated

Sign In for Pricing
View Details