Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316)

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC11 Recombinant Antibody, Biotin Conjugated
bsm-61104R-Biotin-TR 20 µL

HDAC11 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Vmn2r56 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3062202 1.0 µg DNA

Vmn2r56 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rhesus Monkey Vein Frozen Section
NHFF-1123-HX709 Each

Rhesus Monkey Vein Frozen Section

Sign In for Pricing
View Details
ELISA Kit For Carboxypeptidase A1
E15710b 96 Tests

ELISA Kit For Carboxypeptidase A1

Sign In for Pricing
View Details
Lipoprotein associated phospholipase A2 (Lp-PLA2)
E35D1197 50 µg

Lipoprotein associated phospholipase A2 (Lp-PLA2)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Segregation and condensation protein A (scpA)
MBS1162774-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Segregation and condensation protein A (scpA)

Sign In for Pricing
View Details