Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-12 (LV312)

This Recombinant Human Immunoglobulin lambda variable 3-12 (LV312) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-12 IGLV3-12

UniProt

A0A075B6K2

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
18512156 3x 1.0 µg DNA

DOK7 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Anti-ZNF274  (1D8)
YF-MA17485 100 ug

Anti-ZNF274 (1D8)

Sign In for Pricing
View Details
Mycological Peptone
BA 2006 500 g

Mycological Peptone

Sign In for Pricing
View Details
DeoB Antibody
orb813384 2 mg

DeoB Antibody

Sign In for Pricing
View Details
Hepatitis C Virus NS3, aa1359-1456, Genotype 6, Recombinant (HCV)
MBS637143-01 0.1 mg

Hepatitis C Virus NS3, aa1359-1456, Genotype 6, Recombinant (HCV)

Sign In for Pricing
View Details
Hepatitis C Virus NS3, aa1359-1456, Genotype 6, Recombinant (HCV)
MBS637143-02 1 mg

Hepatitis C Virus NS3, aa1359-1456, Genotype 6, Recombinant (HCV)

Sign In for Pricing
View Details