Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-10 (LV310)

This Recombinant Human Immunoglobulin lambda variable 3-10 (LV310) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-10 IGLV3-10

UniProt

A0A075B6K4

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnrc6a ORF Vector (Rat) (pORF)
ORF078062 1.0 µg DNA

Tnrc6a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Two glycerol acyltransferase -O- homolog 2 (DGAT2) ELISA Kit
YP-W12694-01 48 Tests

Human Two glycerol acyltransferase -O- homolog 2 (DGAT2) ELISA Kit

Sign In for Pricing
View Details
Human Two glycerol acyltransferase -O- homolog 2 (DGAT2) ELISA Kit
YP-W12694-02 96 Tests

Human Two glycerol acyltransferase -O- homolog 2 (DGAT2) ELISA Kit

Sign In for Pricing
View Details
GREM1 (Gremlin 1) BioAssayTM ELISA Kit (Rat) discontinued
356101-01 48 Tests

GREM1 (Gremlin 1) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
GREM1 (Gremlin 1) BioAssayTM ELISA Kit (Rat) discontinued
356101-02 96 Tests

GREM1 (Gremlin 1) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
H6pd Rat shRNA Plasmid (Locus ID 298655)
TL705273 1 Kit

H6pd Rat shRNA Plasmid (Locus ID 298655)

Sign In for Pricing
View Details