Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)

This Recombinant Human Immunoglobulin lambda variable 3-9 (LV39) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-9 IGLV3-9

UniProt

A0A075B6K5

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

L1CAM recombinant monoclonal antibody
A5289 100ul X 3

L1CAM recombinant monoclonal antibody

Sign In for Pricing
View Details
TET2-AS1 ORF Vector (Human) (pORF)
46521011 1.0 µg DNA

TET2-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ADAMTS3-set siRNA/shRNA/RNAi Lentivector (Human)
11361091 4x 500 ng

ADAMTS3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal FECH Antibody
NBP1-54841 100 µL

Rabbit Polyclonal FECH Antibody

Sign In for Pricing
View Details
Hepatitis C Virus NS5�GenoType-3� (Recombinant)
22060161-1 100 μg

Hepatitis C Virus NS5�GenoType-3� (Recombinant)

Sign In for Pricing
View Details
2xTaq plus PCR Master Mix
7005500 5 mL

2xTaq plus PCR Master Mix

Sign In for Pricing
View Details