Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)

This Recombinant Human Immunoglobulin lambda variable 3-9 (LV39) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-9 IGLV3-9

UniProt

A0A075B6K5

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRS-3 Polyclonal Antibody
MBS9242852-01 0.1 mL

BRS-3 Polyclonal Antibody

Sign In for Pricing
View Details
BRS-3 Polyclonal Antibody
MBS9242852-02 5x 0.1 mL

BRS-3 Polyclonal Antibody

Sign In for Pricing
View Details
CENTG3 (AGAP3) Human shRNA Plasmid Kit (Locus ID 116988)
TL317788 1 Kit

CENTG3 (AGAP3) Human shRNA Plasmid Kit (Locus ID 116988)

Sign In for Pricing
View Details
SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (Biotin)
251797-Biotin 100 µL

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (Biotin)

Sign In for Pricing
View Details
Quantikine Immunoassay Control Set 1155 for Human CRP
QC70B 1 Each

Quantikine Immunoassay Control Set 1155 for Human CRP

Sign In for Pricing
View Details
(2S) -1- (Chloroacetyl) -2-pyrrolidinecarbonitrile
CS-O-32064 1 Each

(2S) -1- (Chloroacetyl) -2-pyrrolidinecarbonitrile

Sign In for Pricing
View Details