Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)

This Recombinant Human Immunoglobulin lambda variable 3-9 (LV39) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-9 IGLV3-9

UniProt

A0A075B6K5

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC116412 antibody
70R-9053 50 ug

LOC116412 antibody

Sign In for Pricing
View Details
PIP, 29-146aa, Human, His tag, E Coli (Denatured)
MBS205440-01 0.02 mg

PIP, 29-146aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
PIP, 29-146aa, Human, His tag, E Coli (Denatured)
MBS205440-02 0.1 mg

PIP, 29-146aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
PIP, 29-146aa, Human, His tag, E Coli (Denatured)
MBS205440-03 5x 0.02 mg

PIP, 29-146aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
PIP, 29-146aa, Human, His tag, E Coli (Denatured)
MBS205440-04 0.5 mg

PIP, 29-146aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
PIP, 29-146aa, Human, His tag, E Coli (Denatured)
MBS205440-05 5x 0.1 mg

PIP, 29-146aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details