Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11)

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11) spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexanoic-4,4,5,5,6,6,6-d7 Acid
TRC-H292152-2.5MG 2.5 mg

Hexanoic-4,4,5,5,6,6,6-d7 Acid

Sign In for Pricing
View Details
C1s1 Mouse Gene Knockout Kit (CRISPR)
KN502361 1 Kit

C1s1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPKAPK3 Polyclonal Antibody
E-AB-62954-01 60 µL

MAPKAPK3 Polyclonal Antibody

Sign In for Pricing
View Details
MAPKAPK3 Polyclonal Antibody
E-AB-62954-02 120 µL

MAPKAPK3 Polyclonal Antibody

Sign In for Pricing
View Details
MAPKAPK3 Polyclonal Antibody
E-AB-62954-03 200 µL

MAPKAPK3 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS624869 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details