Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11)

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11) spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human D-Tyrosyl-tRNA (Tyr) Deacylase 1/DTD1 (C-6His)
CI72-10ug 10 µg

Recombinant Human D-Tyrosyl-tRNA (Tyr) Deacylase 1/DTD1 (C-6His)

Sign In for Pricing
View Details
Human Absent In Melanoma 1 (AIM1) ELISA Kit
EKU02066-01 48 Tests

Human Absent In Melanoma 1 (AIM1) ELISA Kit

Sign In for Pricing
View Details
Human Absent In Melanoma 1 (AIM1) ELISA Kit
EKU02066-02 96 Tests

Human Absent In Melanoma 1 (AIM1) ELISA Kit

Sign In for Pricing
View Details
Human Absent In Melanoma 1 (AIM1) ELISA Kit
EKU02066-03 5x 96 Tests

Human Absent In Melanoma 1 (AIM1) ELISA Kit

Sign In for Pricing
View Details
12 (R) -Hydroxy-5 (Z),8 (Z),10 (E),14 (Z) -eicosatetraenoic acid
HDA33746 1 mg

12 (R) -Hydroxy-5 (Z),8 (Z),10 (E),14 (Z) -eicosatetraenoic acid

Sign In for Pricing
View Details
Monoclonal RAB2B Antibody (monoclonal) (M02), Clone: 7E5
AMM07463G 0.1mg

Monoclonal RAB2B Antibody (monoclonal) (M02), Clone: 7E5

Sign In for Pricing
View Details