Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentachlorophenol-13C6
TRC-P238178-2.5MG 2.5 mg

Pentachlorophenol-13C6

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D1]
TA805489AM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D1]

Sign In for Pricing
View Details
HE4 Recombinant Rabbit Monoclonal Antibody [JF62-09]
ET1702-61 100 µL

HE4 Recombinant Rabbit Monoclonal Antibody [JF62-09]

Sign In for Pricing
View Details
Enfortumab Biosimilar - Research Grade
ICH5070-10mg 10 mg (2x 5 mg)

Enfortumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant CBS Antibody
RC-15077-01 50 μL

Recombinant CBS Antibody

Sign In for Pricing
View Details
Recombinant CBS Antibody
RC-15077-02 100 µL

Recombinant CBS Antibody

Sign In for Pricing
View Details