Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP7 Rabbit Polyclonal Antibody
AP31724PU-N 100 µg

BMP7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (121-3), CF405S conjugate, 0.1mg/mL
BNC040945-100 1x 100 µL

Double Stranded DNA (dsDNA) (121-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Synapsin I (SYN1) pSer9 Rabbit Polyclonal Antibody
AP02514PU-S 50 µL

Synapsin I (SYN1) pSer9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR560288 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF740 conjugate, 0.1mg/mL
BNC743529-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcat1 Mouse Gene Knockout Kit (CRISPR)
KN502085 1 Kit

Bcat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details