Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat KISS1 (Kisspeptin 1) ELISA Kit
E-EL-R2530-01 24 Tests

Rat KISS1 (Kisspeptin 1) ELISA Kit

Sign In for Pricing
View Details
Rat KISS1 (Kisspeptin 1) ELISA Kit
E-EL-R2530-02 48 Tests

Rat KISS1 (Kisspeptin 1) ELISA Kit

Sign In for Pricing
View Details
Rat KISS1 (Kisspeptin 1) ELISA Kit
E-EL-R2530-03 96 Tests

Rat KISS1 (Kisspeptin 1) ELISA Kit

Sign In for Pricing
View Details
VLDL Receptor (VLDLR) Human Gene Knockout Kit (CRISPR)
KN211796LP 1 Kit

VLDL Receptor (VLDLR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2881), CF488A conjugate, 0.1mg/mL
BNC882881-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2881), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SRRM4 activation kit by CRISPRa
GA113586 1 Kit

Human SRRM4 activation kit by CRISPRa

Sign In for Pricing
View Details