Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1)

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6820408C15Rik CRISPR/Cas9 KO Plasmid (m)
sc-432805 20 µg

6820408C15Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
NELL2 Rabbit Polyclonal Antibody (HRP)
orb2116544 100 µL

NELL2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Myosin VI (m) -PR
sc-37134-PR 10 µM - 20 µL

Myosin VI (m) -PR

Sign In for Pricing
View Details
Flt3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4443503 1.0 µg DNA

Flt3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
UPAR/PLAUR Protein, Human, Recombinant (His Tag)
E45H51295M2-100 100 µg

UPAR/PLAUR Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Anti-Phospho-VIM-(S39) antibody
STJ117904 100 µl

Anti-Phospho-VIM-(S39) antibody

Sign In for Pricing
View Details