Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr630 CRISPR Activation Plasmid (m)
sc-435167-ACT 20 µg

Olfr630 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PRX II Polyclonal Antibody
E44H03116 100 µL

PRX II Polyclonal Antibody

Sign In for Pricing
View Details
HOXA9 (NM_152739) Human 3' UTR Clone
SC213012 10 µg

HOXA9 (NM_152739) Human 3' UTR Clone

Sign In for Pricing
View Details
ERGIC-3 CRISPR/Cas9 KO Plasmid (h)
sc-412226 20 µg

ERGIC-3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anti-Human CLEC5A/MDL1 Antibody (DX246), PerCP
HP329147-01 1 Each

Anti-Human CLEC5A/MDL1 Antibody (DX246), PerCP

Sign In for Pricing
View Details
Anti-Human CLEC5A/MDL1 Antibody (DX246), PerCP
HP329147-02 100 Tests

Anti-Human CLEC5A/MDL1 Antibody (DX246), PerCP

Sign In for Pricing
View Details