Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atad2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4040108 1.0 µg DNA

Atad2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
RAPGEF2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11581R-BF555-TR 20 µL

RAPGEF2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MTMR8/9 CRISPR/Cas9 KO Plasmid (h)
sc-413097 20 µg

MTMR8/9 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anabaseine
TRC-A637150-250MG 250 mg

Anabaseine

Sign In for Pricing
View Details
alpha Internexin (INA) Mouse Monoclonal Antibody [Clone ID: 257CT7.1.2]
TA324344 400 µL

alpha Internexin (INA) Mouse Monoclonal Antibody [Clone ID: 257CT7.1.2]

Sign In for Pricing
View Details
Human Cellular Repressor Of E1A Stimulated Genes 1 (CREG1) ELISA Kit
DLR-CREG1-Hu-48T 48 Tests

Human Cellular Repressor Of E1A Stimulated Genes 1 (CREG1) ELISA Kit

Sign In for Pricing
View Details