Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-28 (KV228)

This Recombinant Human Immunoglobulin kappa variable 2-28 (KV228) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-28 IGKV2-28

UniProt

A0A075B6P5

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum for MeWo Cell Culture
C6573F-50ml 50 mL

Serum for MeWo Cell Culture

Sign In for Pricing
View Details
CDC2 (CDK1) Antibody (C-term)
E45R05921G-1 100 µL

CDC2 (CDK1) Antibody (C-term)

Sign In for Pricing
View Details
Lpin1 3'UTR Lenti-reporter-Luc Vector
27566086 1.0 µg

Lpin1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Deltex 1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-0399R-PE-Cy5 100 µL

Deltex 1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Tyrosinase Inhibitor Screening
MA-0178 100 Well

Tyrosinase Inhibitor Screening

Sign In for Pricing
View Details
Caspase-5 Antibody
orb74595 100 µL

Caspase-5 Antibody

Sign In for Pricing
View Details