Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Di(tert-butoxy)pyrimidine-5-boronic Acid
TRC-D493713-250MG 250 mg

2,4-Di(tert-butoxy)pyrimidine-5-boronic Acid

Sign In for Pricing
View Details
HCN2 Rabbit Polyclonal Antibody
AP01496PU-N 100 µg

HCN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STOML2 Rabbit Polyclonal Antibody
TA370147 100 µL

STOML2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NQO2 Human Gene Knockout Kit (CRISPR)
KN202889BN 1 Kit

NQO2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR560433 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
EIF4E Rabbit Polyclonal Antibody
AP20976PU-N 100 µg

EIF4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details