Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI6D9]
CF810426 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI6D9]

Sign In for Pricing
View Details
CF®405L Maleimide
#92046 1x 1 µmol

CF®405L Maleimide

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF640R conjugate, 0.1mg/mL
BNC402067-500 1x 500 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTL3 (CFAP20) Human Gene Knockout Kit (CRISPR)
KN401017 1 Kit

GTL3 (CFAP20) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tube Furnace BFTU-1300-20-250
BFTU-1300-20-250 1 Unit

Tube Furnace BFTU-1300-20-250

Sign In for Pricing
View Details
Recombinant Mouse Ccl22 Protein (TRX Tag)
PDEM100114-01 20 µg

Recombinant Mouse Ccl22 Protein (TRX Tag)

Sign In for Pricing
View Details