Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2)

This Recombinant Human T cell receptor gamma variable 2 (TRGV2) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccdc96 shRNA (UAS) - Lentiviral mouse Ccdc96 shRNA (UAS) (25)
GTR15273413 1 Vial

Lentiviral mouse Ccdc96 shRNA (UAS) - Lentiviral mouse Ccdc96 shRNA (UAS) (25)

Sign In for Pricing
View Details
Anti-Caveolin-2/CAV2 Antibody Picoband® Fluoro647 Conjugated
PA1540-Fluoro647 100 µg/Vial

Anti-Caveolin-2/CAV2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
TRAV38-2DV8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV787940 1.0 µg DNA

TRAV38-2DV8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus GTP cyclohydrolase III (gch3)
MBS1402853-01 0.02 mg (E-Coli)

Recombinant Sulfolobus solfataricus GTP cyclohydrolase III (gch3)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus GTP cyclohydrolase III (gch3)
MBS1402853-02 0.1 mg (E-Coli)

Recombinant Sulfolobus solfataricus GTP cyclohydrolase III (gch3)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus GTP cyclohydrolase III (gch3)
MBS1402853-03 0.02 mg (Yeast)

Recombinant Sulfolobus solfataricus GTP cyclohydrolase III (gch3)

Sign In for Pricing
View Details