Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 2D-24 (KVD24) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 2D-24 IGKV2D-24

UniProt

A0A075B6R9

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX17 (COX17 Homolog Cytochrome C Oxidase Assembly Protein, Cytochrome C Oxidase Copper Chaperone, Human Homolog of Yeast Mitochondrial Copper Recruitment, MGC104397, MGC117386) (Biotin)
MBS6141323-01 0.1 mL

COX17 (COX17 Homolog Cytochrome C Oxidase Assembly Protein, Cytochrome C Oxidase Copper Chaperone, Human Homolog of Yeast Mitochondrial Copper Recruitment, MGC104397, MGC117386) (Biotin)

Sign In for Pricing
View Details
COX17 (COX17 Homolog Cytochrome C Oxidase Assembly Protein, Cytochrome C Oxidase Copper Chaperone, Human Homolog of Yeast Mitochondrial Copper Recruitment, MGC104397, MGC117386) (Biotin)
MBS6141323-02 5x 0.1 mL

COX17 (COX17 Homolog Cytochrome C Oxidase Assembly Protein, Cytochrome C Oxidase Copper Chaperone, Human Homolog of Yeast Mitochondrial Copper Recruitment, MGC104397, MGC117386) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (AAT/1378)
NBP2-48476-0.02mg 0.02 mg

Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (AAT/1378)

Sign In for Pricing
View Details
Grin3b Mouse shRNA Lentiviral Particle (Locus ID 170483)
TL506051V 500 µL Each

Grin3b Mouse shRNA Lentiviral Particle (Locus ID 170483)

Sign In for Pricing
View Details
Mouse Monoclonal Glut5 Antibody (195205) [Janelia Fluor 669]
FAB1349JF669 0.2 mL

Mouse Monoclonal Glut5 Antibody (195205) [Janelia Fluor 669]

Sign In for Pricing
View Details
NDUFA4L2 Polyclonal Antibody
ABP51908-01 30 µL

NDUFA4L2 Polyclonal Antibody

Sign In for Pricing
View Details