Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29)

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC641520 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6448208 1.0 µg DNA

LOC641520 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
OR5BK1P CRISPR All-in-one AAV vector set (with saCas9)(Human)
35413151 3x 1.0 µg DNA

OR5BK1P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Human PRDM13 Protein
E30P10331 20 µg

Recombinant Human PRDM13 Protein

Sign In for Pricing
View Details
OR2AJ1
526341-01 100 µL

OR2AJ1

Sign In for Pricing
View Details
OR2AJ1
526341-02 200 µL

OR2AJ1

Sign In for Pricing
View Details
MIR4433 Human qPCR Primer Pair (MI0016773)
HP300953 200 Reactions

MIR4433 Human qPCR Primer Pair (MI0016773)

Sign In for Pricing
View Details