Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrfip2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6601106 1.0 µg DNA

Lrrfip2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Goat B cell CLL/lymphoma 9 protein (BCL9) ELISA kit
GTR10466933 96 Well

Goat B cell CLL/lymphoma 9 protein (BCL9) ELISA kit

Sign In for Pricing
View Details
ADAMTSL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11370111 3x 1.0 µg

ADAMTSL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Conjugated PI3 Kinase p110 beta Rabbit mAb
C58907 100 µL

Conjugated PI3 Kinase p110 beta Rabbit mAb

Sign In for Pricing
View Details
RORβ Rabbit mAb
E45R11688N-100 100 µL

RORβ Rabbit mAb

Sign In for Pricing
View Details
Mouse UHRF2 shRNA Plasmid
abx979971-01 150 µg

Mouse UHRF2 shRNA Plasmid

Sign In for Pricing
View Details