Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127)

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-763 inhibitor
HY-RI04038-01 5 nmol

Mmu-miR-763 inhibitor

Sign In for Pricing
View Details
Mmu-miR-763 inhibitor
HY-RI04038-02 20 nmol

Mmu-miR-763 inhibitor

Sign In for Pricing
View Details
CXorf21 (TASL) (NM_025159) Human Tagged Lenti ORF Clone
RC204618L4 10 µg

CXorf21 (TASL) (NM_025159) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DPY19L3 Antibody, FITC conjugated
A58814-100UG 100 µg

DPY19L3 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant ASFV Ba71V-135 Protein (aa 1-111)
VAng-2049Lsx-1mg 1 mg

Recombinant ASFV Ba71V-135 Protein (aa 1-111)

Sign In for Pricing
View Details
Recombinant Pongo abelii Wiskott-Aldrich syndrome protein family member 1 (WASF1), partial
MBS1464739 Inquire

Recombinant Pongo abelii Wiskott-Aldrich syndrome protein family member 1 (WASF1), partial

Sign In for Pricing
View Details