Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127)

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 2C9, NT (CYP2C9, (R) (S) -limonene 6-monooxygenase, (S) -limonene 6-monooxygenase, Cytochrome P450 PB-1, Cytochrome P450 MP-4, Cytochrome P450 MP-8, S-mephenytoin 4-hydroxylase) (MaxLight 750) discontinued
C9095-15J3-ML750 100 µL

Cytochrome p450 2C9, NT (CYP2C9, (R) (S) -limonene 6-monooxygenase, (S) -limonene 6-monooxygenase, Cytochrome P450 PB-1, Cytochrome P450 MP-4, Cytochrome P450 MP-8, S-mephenytoin 4-hydroxylase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)
MBS1436309-01 0.02 mg (E-Coli)

Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)
MBS1436309-02 0.02 mg (Yeast)

Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)
MBS1436309-03 0.1 mg (E-Coli)

Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)
MBS1436309-04 0.1 mg (Yeast)

Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)

Sign In for Pricing
View Details
Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)
MBS1436309-05 0.02 mg (Baculovirus)

Recombinant Mouse Zinc finger and BTB domain-containing protein 5 (Zbtb5)

Sign In for Pricing
View Details