Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1-37 IGKV1-37

UniProt

A0A075B6S9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Netoglitazone
319622 5.0mg

Netoglitazone

Sign In for Pricing
View Details
Lentiviral mouse Ift43 shRNA (UAS) - Lentiviral mouse Ift43 shRNA (UAS, RFP) (25)
GTR15184151 1 Vial

Lentiviral mouse Ift43 shRNA (UAS) - Lentiviral mouse Ift43 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human UNC45B shRNA (UAS) - Lentiviral human UNC45B shRNA (UAS) (100)
GTR15145362 1 Vial

Lentiviral human UNC45B shRNA (UAS) - Lentiviral human UNC45B shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Thioalkalivibrio sp. UPF0178 protein Tgr7_2584 (Tgr7_2584)
MBS1054187-01 0.02 mg (E-Coli)

Recombinant Thioalkalivibrio sp. UPF0178 protein Tgr7_2584 (Tgr7_2584)

Sign In for Pricing
View Details
Recombinant Thioalkalivibrio sp. UPF0178 protein Tgr7_2584 (Tgr7_2584)
MBS1054187-02 0.1 mg (E-Coli)

Recombinant Thioalkalivibrio sp. UPF0178 protein Tgr7_2584 (Tgr7_2584)

Sign In for Pricing
View Details
Recombinant Thioalkalivibrio sp. UPF0178 protein Tgr7_2584 (Tgr7_2584)
MBS1054187-03 0.02 mg (Yeast)

Recombinant Thioalkalivibrio sp. UPF0178 protein Tgr7_2584 (Tgr7_2584)

Sign In for Pricing
View Details