Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2)

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD680 Anti-human CD10 Antibody *HI10a*
10100191-AAT 500 Tests

XFD680 Anti-human CD10 Antibody *HI10a*

Sign In for Pricing
View Details
ELN Protein Vector (Human) (pPM-C-HA)
19231021 500 ng

ELN Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Liprin alpha 2 Rabbit Polyclonal Antibody (BF405)
orb2481566 100 µL

Liprin alpha 2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
KCNIP4 Rabbit Polyclonal Antibody (FITC)
orb2134675 100 µL

KCNIP4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri aaeX Protein (aa 1-67)
VAng-Lsx07586-inquire Inquire

Recombinant Shigella Flexneri aaeX Protein (aa 1-67)

Sign In for Pricing
View Details
Cytoplasmic CysRS Double Nickase Plasmid (h2)
sc-406444-NIC-2 20 µg

Cytoplasmic CysRS Double Nickase Plasmid (h2)

Sign In for Pricing
View Details