Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2)

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Benzene (Glass Distilled)
RG2089-1L 1 L

Ethyl Benzene (Glass Distilled)

Sign In for Pricing
View Details
TRIM Lentiviral Activation Particles (m2)
sc-429563-LAC-2 200 µL

TRIM Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
ATP6V0A2 Human Gene Knockout Kit (CRISPR)
KN209819 1 Kit

ATP6V0A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Protein cereblon (CRBN)
CSB-CF842761HUc7-01 20 µg

Recombinant Human Protein cereblon (CRBN)

Sign In for Pricing
View Details
Recombinant Human Protein cereblon (CRBN)
CSB-CF842761HUc7-02 100 µg

Recombinant Human Protein cereblon (CRBN)

Sign In for Pricing
View Details
GPR37L1 Polyclonal Antibody
ABP57011-01 30 µL

GPR37L1 Polyclonal Antibody

Sign In for Pricing
View Details