Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALR Recombinant Monoclonal Antibody
MBS9019472-01 0.05 mL

CALR Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CALR Recombinant Monoclonal Antibody
MBS9019472-02 0.1 mL

CALR Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CALR Recombinant Monoclonal Antibody
MBS9019472-03 5x 0.1 mL

CALR Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF740 conjugate, 0.1mg/mL
BNC742624-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YAP1 Protein Vector (Mouse) (pPM-C-HA)
PV247952 500 ng

YAP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
N4-Methylcytidine Antibody
16-366 100 µL

N4-Methylcytidine Antibody

Sign In for Pricing
View Details