Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36)

This Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 36/delta variable 7 TRAV36DV7

UniProt

A0A075B6V5

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKFB2 (pS483) Antibody
MBS9232909-01 0.1 mL

PFKFB2 (pS483) Antibody

Sign In for Pricing
View Details
PFKFB2 (pS483) Antibody
MBS9232909-02 5x 0.1 mL

PFKFB2 (pS483) Antibody

Sign In for Pricing
View Details
TBX2 discontinued
336704 100 µL

TBX2 discontinued

Sign In for Pricing
View Details
SLC7A13 Protein Vector (Human) (pPB-N-His)
PV058054 500 ng

SLC7A13 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MAP1LC3A (Microtubule-associated Protein 1 Light Chain 3 alpha, LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3) (MaxLight 550)
MBS6425304-01 0.1 mL

MAP1LC3A (Microtubule-associated Protein 1 Light Chain 3 alpha, LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3) (MaxLight 550)

Sign In for Pricing
View Details
MAP1LC3A (Microtubule-associated Protein 1 Light Chain 3 alpha, LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3) (MaxLight 550)
MBS6425304-02 5x 0.1 mL

MAP1LC3A (Microtubule-associated Protein 1 Light Chain 3 alpha, LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3) (MaxLight 550)

Sign In for Pricing
View Details