Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36)

This Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 36/delta variable 7 TRAV36DV7

UniProt

A0A075B6V5

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf59 siRNA (Human)
CRJ0215-01 15 nmol

C17orf59 siRNA (Human)

Sign In for Pricing
View Details
C17orf59 siRNA (Human)
CRJ0215-02 30 nmol

C17orf59 siRNA (Human)

Sign In for Pricing
View Details
ZFYVE27 Rabbit Polyclonal Antibody (PE-Cy7)
orb917852 100 µL

ZFYVE27 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Anti-JDP2 Antibody Picoband®, Cy3 Conjugate
A04870-2-Cy3 100 µg/Vial

Anti-JDP2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Fenretinide Glucuronide Monosodium Salt
orb1910643 5 mg

Fenretinide Glucuronide Monosodium Salt

Sign In for Pricing
View Details
PDHA1 Rabbit pAb, PerCP-Cy7 conjugated
orb2862563 100 µL

PDHA1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details