Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23)

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23) spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf1
CSB-CL003403HU1 10 μg Plasmid + 200 μL Glycerol

C18orf1

Sign In for Pricing
View Details
MOUSE Brd7 Antibody (Center)
MBS9204705-01 0.08 mL

MOUSE Brd7 Antibody (Center)

Sign In for Pricing
View Details
MOUSE Brd7 Antibody (Center)
MBS9204705-02 0.4 mL

MOUSE Brd7 Antibody (Center)

Sign In for Pricing
View Details
MOUSE Brd7 Antibody (Center)
MBS9204705-03 5x 0.4 mL

MOUSE Brd7 Antibody (Center)

Sign In for Pricing
View Details
CTSZ Antibody, Biotin conjugated
CSB-PA006206LD01HU-01 50 µg

CTSZ Antibody, Biotin conjugated

Sign In for Pricing
View Details
CTSZ Antibody, Biotin conjugated
CSB-PA006206LD01HU-02 100 µg

CTSZ Antibody, Biotin conjugated

Sign In for Pricing
View Details