Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23)

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23) spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNMT Human Pre-designed siRNA Set A
HY-RS09395 1 Set

NNMT Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
MET Protein Lysate
OCOA00088-20UG 20 µg

MET Protein Lysate

Sign In for Pricing
View Details
Rhein
sc-205837 100 mg

Rhein

Sign In for Pricing
View Details
ANKRD53 Mouse Monoclonal Antibody [Clone 2A8]
E45M11035V-2 50 µL

ANKRD53 Mouse Monoclonal Antibody [Clone 2A8]

Sign In for Pricing
View Details
Mouse Serine/arginine-rich splicing factor 12, Srsf12 ELISA KIT
ELI-41225m 96 Tests

Mouse Serine/arginine-rich splicing factor 12, Srsf12 ELISA KIT

Sign In for Pricing
View Details
Heatstable Enterotoxin 1 Antibody, PerCP-Cy5.5 Conjugated
bs-8858R-PerCP-Cy5.5 100 µL

Heatstable Enterotoxin 1 Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details