Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 18 (TVA18)

This Recombinant Human T cell receptor alpha variable 18 (TVA18) spans the amino acid sequence from region 21-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 18 TRAV18

UniProt

A0A075B6X5

Expression Region

21-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQTEGPVTLPERAALTLNCTYQSSYSTFLFWYVQYLNKEPELLLKSSENQETDSRGFQASPIKSDSSFHLEKPSVQLSDSAVYYCALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elymoclavin
TRC-E985790-5MG 5 mg

Elymoclavin

Sign In for Pricing
View Details
Norvinisterone
TRC-N826100-50MG 50 mg

Norvinisterone

Sign In for Pricing
View Details
Human ITLN2 activation kit by CRISPRa
GA115439 1 Kit

Human ITLN2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS801634 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details
ENO1 Antibody
KC-300-01 50 μL

ENO1 Antibody

Sign In for Pricing
View Details
ENO1 Antibody
KC-300-02 100 µL

ENO1 Antibody

Sign In for Pricing
View Details