Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative aquaporin-7B (AQP7B), partial

This Recombinant Human Putative aquaporin-7B (AQP7B), partial spans the amino acid sequence from region 137-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative aquaporin-7B AQP7B

UniProt

A0A075B734

Expression Region

137-174

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details