Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative aquaporin-7B (AQP7B), partial

This Recombinant Human Putative aquaporin-7B (AQP7B), partial spans the amino acid sequence from region 137-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative aquaporin-7B AQP7B

UniProt

A0A075B734

Expression Region

137-174

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST9 (NM_001008693) Human Tagged Lenti ORF Clone
RC220815L3 10 µg

CST9 (NM_001008693) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Kidney Tissue Lysate (Tumor)
orb1672732 0.1 mg

Kidney Tissue Lysate (Tumor)

Sign In for Pricing
View Details
RBP4 (Retinol Binding Protein 4, Plasma) (FITC)
250969-FITC 100 µL

RBP4 (Retinol Binding Protein 4, Plasma) (FITC)

Sign In for Pricing
View Details
CS Polyclonal Antibody, Biotin Conjugated
A52773-100 100 µL

CS Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Helicobacter Phlori (SDT-R273), RPab
CHR-0172-01 3 mL

Helicobacter Phlori (SDT-R273), RPab

Sign In for Pricing
View Details
Helicobacter Phlori (SDT-R273), RPab
CHR-0172-02 6 mL

Helicobacter Phlori (SDT-R273), RPab

Sign In for Pricing
View Details