Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545)

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4,5-Dimethyl-2-oxo-2,3-dihydro-1,3-thiazol-3-yl) acetic acid
BMB26869-01 250 mg

2- (4,5-Dimethyl-2-oxo-2,3-dihydro-1,3-thiazol-3-yl) acetic acid

Sign In for Pricing
View Details
2- (4,5-Dimethyl-2-oxo-2,3-dihydro-1,3-thiazol-3-yl) acetic acid
BMB26869-02 2.5 g

2- (4,5-Dimethyl-2-oxo-2,3-dihydro-1,3-thiazol-3-yl) acetic acid

Sign In for Pricing
View Details
GLS Polyclonal Antibody
E-AB-62763-01 60 µL

GLS Polyclonal Antibody

Sign In for Pricing
View Details
GLS Polyclonal Antibody
E-AB-62763-02 120 µL

GLS Polyclonal Antibody

Sign In for Pricing
View Details
GLS Polyclonal Antibody
E-AB-62763-03 200 µL

GLS Polyclonal Antibody

Sign In for Pricing
View Details
Compound TN12215
orb3178606-01 1 mg

Compound TN12215

Sign In for Pricing
View Details