Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545)

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGA2 Protein Vector (Mouse) (pPB-N-His)
PV181811 500 ng

GGA2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Caspase-10 Rabbit Polyclonal Antibody (PerCP)
orb2445090 100 µL

Caspase-10 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Rac2 (Ras-related C3 botulinum toxin substrate 2., EN-7, Gx, HSPC022, Ras-related C3 botulinum toxin substrate 2, EN 7, EN7, HSPC 022, p21 Rac 2, p21 Rac2, p21Rac2, RAC 2, Ras related C3 botulinum toxin substrate 2, Ras related C3 botulinum toxin substrate 3, Rho family small GTP Binding Protein Rac 2, Rho family small GTP Binding Protein Rac2, Small G Protein) discontinued
350223-01 50 µL

Rac2 (Ras-related C3 botulinum toxin substrate 2., EN-7, Gx, HSPC022, Ras-related C3 botulinum toxin substrate 2, EN 7, EN7, HSPC 022, p21 Rac 2, p21 Rac2, p21Rac2, RAC 2, Ras related C3 botulinum toxin substrate 2, Ras related C3 botulinum toxin substrate 3, Rho family small GTP Binding Protein Rac 2, Rho family small GTP Binding Protein Rac2, Small G Protein) discontinued

Sign In for Pricing
View Details
Rac2 (Ras-related C3 botulinum toxin substrate 2., EN-7, Gx, HSPC022, Ras-related C3 botulinum toxin substrate 2, EN 7, EN7, HSPC 022, p21 Rac 2, p21 Rac2, p21Rac2, RAC 2, Ras related C3 botulinum toxin substrate 2, Ras related C3 botulinum toxin substrate 3, Rho family small GTP Binding Protein Rac 2, Rho family small GTP Binding Protein Rac2, Small G Protein) discontinued
350223-02 100 µL

Rac2 (Ras-related C3 botulinum toxin substrate 2., EN-7, Gx, HSPC022, Ras-related C3 botulinum toxin substrate 2, EN 7, EN7, HSPC 022, p21 Rac 2, p21 Rac2, p21Rac2, RAC 2, Ras related C3 botulinum toxin substrate 2, Ras related C3 botulinum toxin substrate 3, Rho family small GTP Binding Protein Rac 2, Rho family small GTP Binding Protein Rac2, Small G Protein) discontinued

Sign In for Pricing
View Details
Ortho-iodoHoechst 33258
C8568-1 1 mg

Ortho-iodoHoechst 33258

Sign In for Pricing
View Details
Sitafloxacin Impurity 58
RM-S111687-01 10 mg

Sitafloxacin Impurity 58

Sign In for Pricing
View Details