Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-3 Antibody
KC-2140-01 50 μL

Caspase-3 Antibody

Sign In for Pricing
View Details
Caspase-3 Antibody
KC-2140-02 100 µL

Caspase-3 Antibody

Sign In for Pricing
View Details
Caspase-3 Antibody
KC-2140-03 1 mL

Caspase-3 Antibody

Sign In for Pricing
View Details
Human RNF39 activation kit by CRISPRa
GA112944 1 Kit

Human RNF39 activation kit by CRISPRa

Sign In for Pricing
View Details
(S)-Ethyl 2,6-Diisocyanatohexanoate
TRC-E937178-500MG 500 mg

(S)-Ethyl 2,6-Diisocyanatohexanoate

Sign In for Pricing
View Details
PREB Antibody
KC-7739-01 50 μL

PREB Antibody

Sign In for Pricing
View Details