Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432)

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Bis(phenylamino)-2,5-cyclohexadiene-1,4-dione
TRC-B674595-500MG 500 mg

2,5-Bis(phenylamino)-2,5-cyclohexadiene-1,4-dione

Sign In for Pricing
View Details
QuantiChrom™ Whole Blood Hb Kit
DWHB-250 250 Tests

QuantiChrom™ Whole Blood Hb Kit

Sign In for Pricing
View Details
Copper(I) Chloride
TRC-C685280-25G 25 g

Copper(I) Chloride

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF640R conjugate, 0.1mg/mL
BNC402167-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Xylazine-d6 Hydrochloride
TRC-X748002-1MG 1 mg

Xylazine-d6 Hydrochloride

Sign In for Pricing
View Details
Mouse Folr2 activation kit by CRISPRa
GA201462 1 Kit

Mouse Folr2 activation kit by CRISPRa

Sign In for Pricing
View Details