Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GNT6 (UDP-GlcNAc:betaGal Beta-1, -N-Acetylglucosaminyltransferase 6, UDP-GlcNAc:betaGal beta-1, 3-N-Acetylglucosaminyltransferase 6 (Core 3 Synthase) )
476041 100 µL

B3GNT6 (UDP-GlcNAc:betaGal Beta-1, -N-Acetylglucosaminyltransferase 6, UDP-GlcNAc:betaGal beta-1, 3-N-Acetylglucosaminyltransferase 6 (Core 3 Synthase) )

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) rpmA Polyclonal Antibody
MBS7170918 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) rpmA Polyclonal Antibody

Sign In for Pricing
View Details
MEG2 Rabbit pAb, AE conjugated
orb2857303 100 µL

MEG2 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Anterior Gradient 2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-5123R-BF350 100 µL

Anterior Gradient 2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Recombinant Human SRP19
MBS7616345-01 0.05 mg

Recombinant Human SRP19

Sign In for Pricing
View Details
Recombinant Human SRP19
MBS7616345-02 0.2 mg

Recombinant Human SRP19

Sign In for Pricing
View Details