Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NACAD Protein Vector (Human) (pPM-C-HA)
PV103484 500 ng

NACAD Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Guinea pig CML-AGE ELISA Kit
NSL0094Gp 96 Tests

Guinea pig CML-AGE ELISA Kit

Sign In for Pricing
View Details
Clostridium botulinum Neurotoxin Type A (botA) Antibody
abx461765-01 100 µg

Clostridium botulinum Neurotoxin Type A (botA) Antibody

Sign In for Pricing
View Details
Clostridium botulinum Neurotoxin Type A (botA) Antibody
abx461765-02 1 mg

Clostridium botulinum Neurotoxin Type A (botA) Antibody

Sign In for Pricing
View Details
Human SLC24A3 qPCR Primer Pair
QH47837S 200 Tests

Human SLC24A3 qPCR Primer Pair

Sign In for Pricing
View Details
ATP2B4 (NM_001684) Human Tagged ORF Clone Lentiviral Particle
RC213835L3V 200 µL

ATP2B4 (NM_001684) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details