Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15)

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB3 Protein (N-His, Human)
P503663 100 µg

ERBB3 Protein (N-His, Human)

Sign In for Pricing
View Details
EHMT1 CRISPRa sgRNA lentivector (set of three targets)(Human)
19057121 3x 1.0µg DNA

EHMT1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
C8a 3'UTR Lenti-reporter-Luc Vector
14717086 1.0 µg

C8a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Ghrelin (GHRL)
MBS2108225-01 0.1 mL

HRP-Linked Monoclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Ghrelin (GHRL)
MBS2108225-02 0.2 mL

HRP-Linked Monoclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Ghrelin (GHRL)
MBS2108225-03 0.5 mL

HRP-Linked Monoclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details