Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08)

This Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-8 IGKV1D-8

UniProt

A0A087WSZ0

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIWMTQSPSLLSASTGDRVTISCRMSQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPBL CRISPR Activation Plasmid (h2)
sc-403371-ACT-2 20 µg

NIPBL CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4) (MaxLight 650)
MBS6226918-01 0.1 mL

CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4) (MaxLight 650)

Sign In for Pricing
View Details
CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4) (MaxLight 650)
MBS6226918-02 5x 0.1 mL

CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4) (MaxLight 650)

Sign In for Pricing
View Details
C9orf153 (NM_001010907) Human Tagged Lenti ORF Clone
RC217431L4 10 µg

C9orf153 (NM_001010907) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PerCP/Cy5.5 Anti-human CD56 Antibody *My31*
105621T2-AAT 500 Tests

PerCP/Cy5.5 Anti-human CD56 Antibody *My31*

Sign In for Pricing
View Details
Cholesteryl palmitate
MBS5751537 Inquire

Cholesteryl palmitate

Sign In for Pricing
View Details