Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30)

This Recombinant Human T cell receptor alpha variable 30 (TVA30) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SHC1 Antibody (OTI3A1) [Janelia Fluor 646]
NBP2-74167JF646 0.1 mL

Mouse Monoclonal SHC1 Antibody (OTI3A1) [Janelia Fluor 646]

Sign In for Pricing
View Details
ACE2 (18-615) Protein
BSV-COV-PR-16 50 ug

ACE2 (18-615) Protein

Sign In for Pricing
View Details
LOC502176 AAV siRNA Pooled Vector
27316166 1.0 µg

LOC502176 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MOCS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
30295067 1.0 µg DNA

MOCS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
OTTMUSG00000003605 shRNA Plasmid (m)
sc-151422-SH 20 µg

OTTMUSG00000003605 shRNA Plasmid (m)

Sign In for Pricing
View Details
2-Acrylamidophenylboronic acid
414868-01 50 mg

2-Acrylamidophenylboronic acid

Sign In for Pricing
View Details