Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WHSC2 Protein Vector (Rat) (pPB-C-His)
PV316562 500 ng

WHSC2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
IFluor® 450 Anti-human/ non-human primates CD137 Antibody *4B4-1*
11370040-AAT 100 Tests

IFluor® 450 Anti-human/ non-human primates CD137 Antibody *4B4-1*

Sign In for Pricing
View Details
DBX2 (NM_001004329) Human Over-expression Lysate
LS440097-20ug 20 µg

DBX2 (NM_001004329) Human Over-expression Lysate

Sign In for Pricing
View Details
IFIT3 (B-7) Alexa Fluor® 546
sc-393512 AF546 200 µg/mL

IFIT3 (B-7) Alexa Fluor® 546

Sign In for Pricing
View Details
Mouse Ephrin B2 (EFNB2) ELISA Kit
MBS2705368-01 24 Strip Well

Mouse Ephrin B2 (EFNB2) ELISA Kit

Sign In for Pricing
View Details
Mouse Ephrin B2 (EFNB2) ELISA Kit
MBS2705368-02 48 Well

Mouse Ephrin B2 (EFNB2) ELISA Kit

Sign In for Pricing
View Details