Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1)

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CB-7921220 10mM * 1mL in DMSO
A19934-10mM-D 10 mM x 1mL in DMSO

CB-7921220 10mM * 1mL in DMSO

Sign In for Pricing
View Details
CSNK2B Antibody
E10-30718T 100 µL

CSNK2B Antibody

Sign In for Pricing
View Details
CYP17A1 siRNA (m)
sc-45642 10 µM

CYP17A1 siRNA (m)

Sign In for Pricing
View Details
Phospho-IKK beta (S474) Rabbit Polyclonal Antibody (BF750)
orb1809935 100 µL

Phospho-IKK beta (S474) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Rat Monoclonal PIR-A/B Antibody (404127) [FITC]
FAB5308F 0.1 mL

Rat Monoclonal PIR-A/B Antibody (404127) [FITC]

Sign In for Pricing
View Details
Dividers for 100 mm boxes 136x136, grid 3 x 3, H: 65 mm
TE22740 36 Cases

Dividers for 100 mm boxes 136x136, grid 3 x 3, H: 65 mm

Sign In for Pricing
View Details