Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-40 (KV240)

This Recombinant Human Immunoglobulin kappa variable 2-40 (KV240) spans the amino acid sequence from region 20-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-40 IGKV2-40

UniProt

A0A087WW87

Expression Region

20-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM2 CRISPR Activation Plasmid (m)
sc-420714-ACT 20 µg

GSTM2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Trigonelline
N2788-20 20 mg

Trigonelline

Sign In for Pricing
View Details
Fbx15 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8396R-APC-Cy5.5 100 µL

Fbx15 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human E2F6, GST-tagged
E2F6-12249H 25 µg

Recombinant Human E2F6, GST-tagged

Sign In for Pricing
View Details
Tetrabutylphosphonium acetate
OR1067361-01 1 g

Tetrabutylphosphonium acetate

Sign In for Pricing
View Details
Tetrabutylphosphonium acetate
OR1067361-02 5 g

Tetrabutylphosphonium acetate

Sign In for Pricing
View Details