Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17)

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crystallin Alpha B (CPTC-CRYAB-1), CF594 conjugate, 0.1mg/mL
BNC942235-500 1x 500 µL

Crystallin Alpha B (CPTC-CRYAB-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TrkA (NTRK1) Mouse Monoclonal Antibody [Clone ID: OTI5B6]
CF806413 100 µg

TrkA (NTRK1) Mouse Monoclonal Antibody [Clone ID: OTI5B6]

Sign In for Pricing
View Details
SH3TC1 (C-term) Rabbit Polyclonal Antibody
AP53784PU-N 400 µL

SH3TC1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF740 conjugate, 0.1mg/mL
BNC741317-100 1x 100 µL

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]
TA806598AM 100 µL

GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details
CA5A (NM_001739) Human Over-expression Lysate
LY419773 100 µg

CA5A (NM_001739) Human Over-expression Lysate

Sign In for Pricing
View Details