Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17)

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Benzoxazolinone
TRC-B315730-5G 5 g

2-Benzoxazolinone

Sign In for Pricing
View Details
PRPSAP1 (NM_002766) Human Over-expression Lysate
LY419124 100 µg

PRPSAP1 (NM_002766) Human Over-expression Lysate

Sign In for Pricing
View Details
TPCA-1
TRC-T700500-5MG 5 mg

TPCA-1

Sign In for Pricing
View Details
Mouse Edn2 activation kit by CRISPRa
GA201179 1 Kit

Mouse Edn2 activation kit by CRISPRa

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-500 1x 500 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzylidene Camphor Sulfonic Acid
TRC-B280038-50MG 50 mg

Benzylidene Camphor Sulfonic Acid

Sign In for Pricing
View Details